PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.002G201000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 329aa    MW: 34206.3 Da    PI: 7.4352
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.002G201000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.71.2e-171461148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEd+ lv +v+++G+g+W++++   g+ R+ k+c++rw +yl
  Sobic.002G201000.1.p 14 KGPWTPEEDLMLVSYVQEHGPGNWRAVPTNTGLMRCSKSCRLRWTNYL 61
                          79********************************************97 PP

2Myb_DNA-binding50.74.3e-1667112148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rg++T +E++l++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Sobic.002G201000.1.p  67 RGNFTDQEEKLIIHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                           89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-24564IPR009057Homeodomain-like
PROSITE profilePS5129424.935965IPR017930Myb domain
SuperFamilySSF466891.35E-3011108IPR009057Homeodomain-like
SMARTSM007177.5E-141363IPR001005SANT/Myb domain
PfamPF002491.4E-161461IPR001005SANT/Myb domain
CDDcd001671.96E-111661No hitNo description
Gene3DG3DSA:1.10.10.601.0E-2465117IPR009057Homeodomain-like
PROSITE profilePS5129420.59266116IPR017930Myb domain
SMARTSM007172.5E-1666114IPR001005SANT/Myb domain
PfamPF002494.2E-1567112IPR001005SANT/Myb domain
CDDcd001671.60E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009617Biological Processresponse to bacterium
GO:0009626Biological Processplant-type hypersensitive response
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042761Biological Processvery long-chain fatty acid biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MGRPPCCDKV GVKKGPWTPE EDLMLVSYVQ EHGPGNWRAV PTNTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TDQEEKLIIH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLKKMQ  120
AGEGDGGEDG GAAGASEGGA GAGATAGGGG KRPAVPKGQW ERRLQTDIHT ARQALRDALS  180
LEPSAQPLAP AKVEPLPTTP PGCTTYASSA ENIARLLEGW LRPGGGGGKG PEASGSTSTT  240
ATTQQRPQCS GEGAASASAS HSGGAAANTA AQTPECSTET SKMAGAAGSA PPAFSMLESW  300
LLDDGGMGHG EVGLMTDVVP LGDPSEFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C6e-27141164105C-Myb DNA-Binding Domain
1mse_C6e-27141164105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00386DAPTransfer from AT3G28910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1651780.0AC165178.2 Zea mays clone ZMMBBb-272P17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008652703.10.0PREDICTED: myb-related protein 306-like
SwissprotP813921e-110MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A096QJ490.0A0A096QJ49_MAIZE; Uncharacterized protein
STRINGGRMZM2G045748_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.11e-95myb domain protein 94